DDX26B (INTS6L) Rabbit Polyclonal Antibody TA341634 from OriGene Technologies | Biocompare.com

Supplier Images

DDX26B (INTS6L) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
DDX26B (INTS6L) Rabbit Polyclonal Antibody

The DDX26B (INTS6L) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Human antigen. The DDX26B (INTS6L) Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-DDX26B Antibody

Product Specs
ItemDDX26B (INTS6L) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA341634
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
ReactivityHuman
TargetINTS6L
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-DDX26B antibody: synthetic peptide directed towards the N terminal of human DDX26B. Synthetic peptide located within the following region: ASTEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQCLESLVQKVQ
NCBI Full Gene Nameintegrator complex subunit 6 like
NCBI Gene AliasesDDX26B
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!